PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g13470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 272aa    MW: 30663 Da    PI: 7.2975
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g13470genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-323588255
    G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               prlrWtp+LH++Fv+av+ LGG+ +AtPk +l++m+vkgLt++hvkSHLQ+YR 
  Tp2g13470 35 PRLRWTPDLHRCFVNAVDMLGGQYRATPKLVLKMMDVKGLTISHVKSHLQMYRG 88
               8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9393191IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-293188IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-233588IPR006447Myb domain, plants
SuperFamilySSF466891.15E-143587IPR009057Homeodomain-like
PfamPF002491.4E-83687IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGKCGGRNSN GNYNGVGFNG HGGDGVRPYV RSPVPRLRWT PDLHRCFVNA VDMLGGQYRA  60
TPKLVLKMMD VKGLTISHVK SHLQMYRGSK LTLGKPEESS SSSIRRRQDT EEDYLHDNLS  120
LHPRNDCLLG FHSFPLSSHS SLRGGGRRKK QTSETGGDDD DADFLHIMNM KKTKETTTFP  180
SHHFHKETEK EKNNWKNTWQ EEEQEHEHEE EQEDLSLSLS LNHHHWRSNG SSVSETSEAV  240
STCSAPFVFK DCFASSPKID LNLNLSISLL GS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2229241e-145HM222924.1 Thellungiella parvula phosphatase, cyclin J18, clathrin assembly protein-related protein, BPC1, SGR5/ATIDD15, leucine-rich receptor kinase, endomemebrane protein 70, salt overly sensitive 1, glutamate decarboxylae 4, oligopeptide transport protein, peptide transporter, and NADH-ubiquinone oxidoreductase B18 genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693582.11e-151PREDICTED: putative Myb family transcription factor At1g14600
SwissprotQ700D92e-85MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLE5F7091e-172E5F709_9BRAS; Putative uncharacterized protein
STRINGBra026618.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.14e-69G2-like family protein
Publications ? help Back to Top
  1. Oh DH, et al.
    Genome structures and halophyte-specific gene expression of the extremophile Thellungiella parvula in comparison with Thellungiella salsuginea (Thellungiella halophila) and Arabidopsis.
    Plant Physiol., 2010. 154(3): p. 1040-52
    [PMID:20833729]