PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g12950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 284aa    MW: 33192.5 Da    PI: 6.0594
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g12950genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.29e-2159117356
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                +R+++t+eq+++Lee +++  r+p++e+++++A+kl    +++ ++V++WFqN++a+e+
  Tp2g12950  59 SRWNPTPEQITTLEEIYRRgIRTPTTEQIQQIASKLrkygRIEGKNVFYWFQNHKARER 117
                7*****************99*************************************98 PP

2Wus_type_Homeobox113.69.9e-3757119264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        a++RW+PtpeQi+ Lee+y++G+rtP++e+iq+i+++L++yG+ie+kNVfyWFQN+kaRer k
          Tp2g12950  57 ASSRWNPTPEQITTLEEIYRRGIRTPTTEQIQQIASKLRKYGRIEGKNVFYWFQNHKARERLK 119
                        689**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.22454119IPR001356Homeobox domain
SMARTSM003892.0E-556123IPR001356Homeobox domain
SuperFamilySSF466897.45E-1257117IPR009057Homeodomain-like
PfamPF000462.2E-1859117IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-859117IPR009057Homeodomain-like
CDDcd000867.41E-660117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0016049Biological Processcell growth
GO:0048314Biological Processembryo sac morphogenesis
GO:0048446Biological Processpetal morphogenesis
GO:0048482Biological Processplant ovule morphogenesis
GO:0051301Biological Processcell division
GO:0048353Cellular Componentprimary endosperm nucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGYISNNNLI NYLPLSTTQP HLLQTQSDTH SNDHHHQLIT SSSGELGDQK TNVPTAASSR  60
WNPTPEQITT LEEIYRRGIR TPTTEQIQQI ASKLRKYGRI EGKNVFYWFQ NHKARERLKR  120
RRCEGDHDIN NVREQLKDVK DSSSGGYAVD QTKSCPSFPY TNPQPQKELV RENYNKDINI  180
NNEDHGTTEE SERASDDGKD ATWRNLVTSL VIQEQGENNI DENRYNVNGE VEEEEKREIR  240
TLDLFPLMEN QERTDRFAEK KHIKANQMCC NYCYYYEFMP LKNN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398542.11e-139hypothetical protein EUTSA_v10001174mg
SwissprotQ9ZVF51e-122WOX6_ARATH; WUSCHEL-related homeobox 6
TrEMBLV4KQ451e-139V4KQ45_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__60__AT2G01500.11e-136(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.11e-115WOX family protein