PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g11160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 163aa    MW: 19049 Da    PI: 10.2825
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g11160genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.61.1e-15957149
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               k ie++++rq+tfs+R++gi+ KA+ L  L d+evav+i s+tg+ y +
  Tp2g11160  9 KYIEDNTKRQITFSNRQAGIFTKASALARLFDVEVAVLINSPTGQPYIF 57
               579*****************************************97765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.782161IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-20160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-20276IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-12323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-161157IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGRRKIEVKY IEDNTKRQIT FSNRQAGIFT KASALARLFD VEVAVLINSP TGQPYIFGSP  60
CFYSVVGHLR NPYPRRTRTS SSLKQLRILK KQAKLDRLTN ELEMQNEYEK VLRKRLEDTL  120
ANYNMKEVKY PTLDEFVAFK EKLETQLDNL KSKRVVMDDS LSH
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp2g11160
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398327.13e-46agamous-like MADS-box protein AGL29
TrEMBLV4KPE96e-45V4KPE9_EUTSA; Uncharacterized protein
STRINGXP_006398327.11e-45(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1548036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47760.11e-37AGAMOUS-like 102