PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g10860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 337aa    MW: 37697.4 Da    PI: 6.1619
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g10860genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.12.6e-1754114257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                ++R+++++eq+++Le+ F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  Tp2g10860  54 KPRWNPKPEQIRILESIFNSgIVNPPRDEIQRIRIRLqeygQIGDANVFYWFQNRKSRAKH 114
                89*****************99*************************************995 PP

2Wus_type_Homeobox1116.6e-3653115264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++eiqri+ +L+eyG+i+d+NVfyWFQNrk+R ++k
          Tp2g10860  53 PKPRWNPKPEQIRILESIFNSGIVNPPRDEIQRIRIRLQEYGQIGDANVFYWFQNRKSRAKHK 115
                        579**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.97750115IPR001356Homeobox domain
SuperFamilySSF466891.92E-1152117IPR009057Homeodomain-like
SMARTSM003891.7E-652119IPR001356Homeobox domain
CDDcd000861.23E-753115No hitNo description
Gene3DG3DSA:1.10.10.601.4E-654114IPR009057Homeodomain-like
PfamPF000466.6E-1554114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSSSNKNWPS MFKSKPCNNH HHQHHRDMDT PSYMHYSNCN ISSPFSSDRV PDPKPRWNPK  60
PEQIRILESI FNSGIVNPPR DEIQRIRIRL QEYGQIGDAN VFYWFQNRKS RAKHKLRVLK  120
KNPKMSGCNP NKTRKDRIIT PSDDTDPCFG LVNQETGLFQ GQNNELVITE PASFLYPVDN  180
DPNLTQSGFG FGGFVVPVVT EERMEFAAVN NGVNMNIPEI NFDGGGNGYF PNSIPVTIPL  240
TINQSQVPGD VVLSGVGETG DCVSPVKLTV FINDIPFEVV AGLFNVKEAF GNDAVLINSF  300
GQPVLTDESG VTFQPLQNGA VYYLVSFYCD IQNFSQT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514001e-121AY251400.1 Arabidopsis thaliana WOX8 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619706.10.0PREDICTED: WUSCHEL-related homeobox 8 isoform X1
SwissprotQ6X7J51e-170WOX8_ARATH; WUSCHEL-related homeobox 8
TrEMBLA0A078DH330.0A0A078DH33_BRANA; BnaC02g32050D protein
STRINGBra022008.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142621619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.11e-161WUSCHEL related homeobox 8