PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g05320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 334aa    MW: 37665.8 Da    PI: 8.4652
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g05320genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.85e-121149341
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
               i++ + r+ +f  R++g++KK +EL vLCd++++ +i+ 
  Tp2g05320 11 ISDGTARKKSFNYRKKGLMKKLSELKVLCDVDACAVIYN 49
               89999*****************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-16160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.273150IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-20295IPR002100Transcription factor, MADS-box
CDDcd002662.85E-22278No hitNo description
PRINTSPR004042.7E-5323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-121150IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRKKLDLTY ISDGTARKKS FNYRKKGLMK KLSELKVLCD VDACAVIYNQ FNSSPQVWPS  60
KSGVKKILEK FEMLTEKEKT CRSVTHEEFL NHEIKKVRKK IQQLTEENKE TYMRELMFGC  120
LSGNMGDLIL NDNDRPDLCT VIDQYVKNLI QHKNLSLNNP NFEIGESSSM AMARNLAPPT  180
TGEVGSSSFL NNSTFNSSQP TNNLKSIISS NKGPEHVISL ASNFLNAPTL NSLKVSSKLK  240
PKITSSGRIA QDNSVASIPQ TSSNQEVYTP VMNQDEFYNL NQNQIMQQRF VEEMMKLGEQ  300
TCFPWMEVNH HSTSVDADAN GTNVMSHLCS RNDI
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp2g05320
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018437602.11e-104PREDICTED: agamous-like MADS-box protein AGL80 isoform X1
TrEMBLA0A0D3AA301e-114A0A0D3AA30_BRAOL; Uncharacterized protein
STRINGBo1g088030.11e-115(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.13e-96AGAMOUS-like 46