PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g02240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 390aa    MW: 43818.2 Da    PI: 6.7604
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g02240genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-093163502155
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                k +yps++++  LA+++gL+++q+ +WF N+R ++
  Tp2g02240 316 KWPYPSEQQKLALAESTGLDQKQINNWFINQRKRH 350
                569*****************************885 PP

2ELK414e-14270291122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLlrKYsgyLgsLkqEF+
  Tp2g02240 270 ELKGQLLRKYSGYLGSLKQEFM 291
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.9E-18127171IPR005540KNOX1
PfamPF037901.4E-20129167IPR005540KNOX1
SMARTSM012561.1E-26178229IPR005541KNOX2
PfamPF037917.8E-21182227IPR005541KNOX2
PROSITE profilePS5121311.174270290IPR005539ELK domain
PfamPF037896.6E-11270291IPR005539ELK domain
SMARTSM011882.8E-8270291IPR005539ELK domain
PROSITE profilePS5007113.151290353IPR001356Homeobox domain
SuperFamilySSF466891.5E-19292368IPR009057Homeodomain-like
SMARTSM003895.3E-13292357IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-28295355IPR009057Homeodomain-like
CDDcd000863.50E-12302354No hitNo description
PfamPF059203.5E-17310349IPR008422Homeobox KN domain
PROSITE patternPS000270328351IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MESGSNSTSC PMAFAGDNSD GPMCPMMMMM MPVMTSNQHQ QHHGHGPQHQ HQQQQHDGYA  60
YQSHHQQSSS LFLQSLAPPP SQETKNKVAS SSSPSSCAPA YSLMEIHHQN DLVAGGLNPC  120
SSSSSSASVK AKIMAHPHYH RLLLAYVNCQ KVGAPPEVQA RLEETCSSAA AAAASMGPTG  180
SLGEDPGLDQ FMEAYCEMLV KYEQELSKPF KEAMVFLQRV ECQFKSLSLS SPSSFSGYGE  240
TTIDRNNNGS SEEEVDMNNE FIDPQAEDRE LKGQLLRKYS GYLGSLKQEF MKKRKKGKLP  300
KEARQQLLDW WSRHYKWPYP SEQQKLALAE STGLDQKQIN NWFINQRKRH WKPSEDMQFV  360
VMDATHPHHY FMDNVLGNPF PIDHITSNML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1285294LKQEFMKKRK
2291295KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4805850.0GU480585.1 Brassica rapa SHOOT MERISTEMLESS (STM) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302988.10.0homeobox protein SHOOT MERISTEMLESS
SwissprotQ9M6D90.0STM_BRAOL; Homeobox protein SHOOT MERISTEMLESS
TrEMBLD4NZH60.0D4NZH6_BRANA; SHOOT MERISTEMLESS
STRINGBra027050.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64732644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.10.0KNOX/ELK homeobox transcription factor