PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g00690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 192aa    MW: 21357 Da    PI: 7.5804
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g00690genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32110168159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dpkvv++tYeg Hnh+
  Tp2g00690 110 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPKVVVTTYEGVHNHP 168
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.8E-3397168IPR003657WRKY domain
SuperFamilySSF1182902.48E-28102169IPR003657WRKY domain
PROSITE profilePS5081129.746105170IPR003657WRKY domain
SMARTSM007743.0E-38110169IPR003657WRKY domain
PfamPF031063.3E-26111168IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MEGVDDTNPM LTLEDGENNP FSSFEDKTLM MMAPSLMFSG DMGPSSSSCS PAIFHMSAQP  60
ENFQGGGGGG GDAVEMGGLS DHNKNNKGKG KRSSAMQRIA FHTRSDDDVL DDGYRWRKYG  120
QKSVKNNAHP RSYYRCTYHT CNVKKQVQRL AKDPKVVVTT YEGVHNHPCE KLMETLSPLL  180
RQLQFLTRVS DL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-27100167774Probable WRKY transcription factor 4
2lex_A5e-27100167774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931630.0KM593163.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY115) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112904.11e-128PREDICTED: probable WRKY transcription factor 56
SwissprotQ8VWQ41e-112WRK56_ARATH; Probable WRKY transcription factor 56
TrEMBLM4EFW21e-128M4EFW2_BRARP; Uncharacterized protein
STRINGBra027675.1-P1e-127(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-103WRKY DNA-binding protein 56