PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g41580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 159aa    MW: 17488.4 Da    PI: 4.9822
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g41580genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.63.2e-1990133952
    G2-like   9 eLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                +LH++F+eav++L G+ekAt k++ +lm+v+gLt+++ kSHLQk
  Tp1g41580  90 NLHNCFLEAVRKLDGPEKATRKAVTKLMDVEGLTIYQAKSHLQK 133
                79*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1690136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1490133IPR006447Myb domain, plants
SuperFamilySSF466897.17E-891134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MNSNSLLSID GGNSACSSSS LSSLHNFVNI QPTETTTNFH FNGGYSSLLT LSGDAFSDDS  60
FSLSEQMELQ FLSAELELAI TDRARTPRLN LHNCFLEAVR KLDGPEKATR KAVTKLMDVE  120
GLTIYQAKSH LQKQESQLPS SSAKDDECET SPKRPRLEN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147458.13e-29PREDICTED: uncharacterized protein LOC103871004
TrEMBLA0A087H0932e-33A0A087H093_ARAAL; Uncharacterized protein
STRINGBra038033.1-P1e-28(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.24e-27G2-like family protein