PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g41220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 476aa    MW: 52948.3 Da    PI: 4.5675
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g41220genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.77.6e-31294351259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                dDg++WrKYGqK+vkg+++prsYY+Ct++gC+vkk+ver ++d k+v+ tY g H+h+
  Tp1g41220 294 DDGFRWRKYGQKVVKGNPNPRSYYKCTYSGCNVKKHVERGSDDVKLVVNTYDGIHEHP 351
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-31278353IPR003657WRKY domain
SuperFamilySSF1182903.27E-26287353IPR003657WRKY domain
PROSITE profilePS5081133.235288353IPR003657WRKY domain
SMARTSM007745.6E-35293352IPR003657WRKY domain
PfamPF031062.0E-23294351IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MNDCDGSFME MTSHWAPPSS PSPRTILAML NQTDNDNGLN PISEIFPQTS LSANHQSEQR  60
SGLTERVATR IGFTLPPLQT ENMSPFAAFF RNPTTVPSPV VPISPGYSPS ALLQSPNILS  120
DSSHIIPPSP IANDGPPDTV ESSGDNHATS MTINNDVHHQ PMHDDLPPQE DSDDIPTEES  180
VYMPSYESHS VYIPSHVDPI GAPLVASFES EVVDETDIIN LISLESESES ENEEYIDVQD  240
EDEDEIHDIV DELDVEPSSP KRRKFEVSSM IGATRTSKNQ RVIIQMECEE DLPDDGFRWR  300
KYGQKVVKGN PNPRSYYKCT YSGCNVKKHV ERGSDDVKLV VNTYDGIHEH PAPAARISTS  360
GTRSRSGSSM SQDHHSNQRT TRLGRPPSSS LASQDMRHFS SSLEHMRPFS SSVDPQIDMT  420
QLYMTGLSKL PSLPGNQNRG FMYRNDEPRI DHVTSDGTEV YKGIMDRLFR NFGVNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-26284354878Probable WRKY transcription factor 4
1wj2_A6e-26284354878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392618.10.0hypothetical protein EUTSA_v10012199mg
SwissprotQ9LG051e-164WRK10_ARATH; Probable WRKY transcription factor 10
TrEMBLV4KFE80.0V4KFE8_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10042080.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102991733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.12e-72WRKY DNA-binding protein 10