PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g39700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SBP
Protein Properties Length: 174aa    MW: 19881.5 Da    PI: 10.3618
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g39700genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.6e-4254130177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +Cqv++C++dl+eak+yhrrhkvCevh+ka+ v+++g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  Tp1g39700  54 ICQVDRCTTDLKEAKQYHRRHKVCEVHAKATFVFLAGVSQRFCQQCSRFHELLEFDEAKRSCRRRLAGHNERRRKST 130
                5**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375753.0E-571142IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.103.4E-3249116IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.88152129IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-3854133IPR004333Transcription factor, SBP-box
PfamPF031108.3E-3255128IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEGKKPQGQG YLKKKASVSY LVGEELENDT DGEEEEKRKG VVGRFKVSSG SSRICQVDRC  60
TTDLKEAKQY HRRHKVCEVH AKATFVFLAG VSQRFCQQCS RFHELLEFDE AKRSCRRRLA  120
GHNERRRKST GESFGEGSGG RRGITGQVIQ NQERPRVEMT LPMSNSSFKR PQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-4448128284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534391e-128AK353439.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-M04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646323.11e-103PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
RefseqXP_013646324.11e-103PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
RefseqXP_013752441.11e-103PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
RefseqXP_013752442.11e-103PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ9S7A95e-78SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A078GKE91e-100A0A078GKE9_BRANA; Squamosa promoter-binding-like protein
STRINGBra039656.1-P6e-96(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-67squamosa promoter binding protein-like 4