PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g36430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 367aa    MW: 41186.5 Da    PI: 6.8681
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g36430genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32225280156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++WtpeLH+rFv+a++qLGG+ +AtPk+i+e+m+ +gLt+++vkSHLQkYRl+
  Tp1g36430 225 KQRRCWTPELHRRFVDALQQLGGPGVATPKQIREHMQEDGLTNDEVKSHLQKYRLH 280
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.263222282IPR017930Myb domain
SuperFamilySSF466894.66E-18223283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-28224283IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-26225280IPR006447Myb domain, plants
PfamPF002493.5E-9227278IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGSLGDELSL GSRRRHSSMP ITICGFPRKV SKIMNVAVEK GCKLDEHVKK LEEEKRKIQG  60
CELELPLCLQ ILNDAISYLK EENKRWSEMD TKPLLRDFIS LNKPCLLDEE EWRGGDGIDV  120
QLLKREERVE EKKFQLWREN DHISDTKINS NKLDIVSNEE KSSNGLSMLL IPGMRTPKVE  180
TGLGLGLTSS SMVNGRRKGI ASCGLTSNSV PPQPPPFLQQ QALRKQRRCW TPELHRRFVD  240
ALQQLGGPGV ATPKQIREHM QEDGLTNDEV KSHLQKYRLH IRKPNSNPEK QSVVVLGFNL  300
WNSSQEEEES GEGGGGESSK RSNSQSDSPQ GPLQLPSTTT TTGGDSSMED AEDAKSESFQ  360
MERLRSP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2216311e-138AK221631.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-96-G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006393245.10.0hypothetical protein EUTSA_v10011605mg
TrEMBLV4MGV80.0V4MGV8_EUTSA; Uncharacterized protein
STRINGBra040662.1-P1e-158(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139271824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.11e-126G2-like family protein