PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g34210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 257aa    MW: 29319.9 Da    PI: 9.8591
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g34210genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox664.9e-2191150357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Tp1g34210  91 TRWNPTQEQIGILEMLYKGgMRTPNAQQIEHITSQLgkygKIEGKNVFYWFQNHKARERQ 150
                7*****************99**************************************97 PP

2Wus_type_Homeobox116.71.1e-3791152465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+lyk G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
          Tp1g34210  91 TRWNPTQEQIGILEMLYKGGMRTPNAQQIEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQ 152
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.02586151IPR001356Homeobox domain
SuperFamilySSF466893.12E-1288155IPR009057Homeodomain-like
SMARTSM003892.0E-788155IPR001356Homeobox domain
CDDcd000867.31E-591152No hitNo description
PfamPF000461.1E-1891150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.6E-892150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MKVHEFSNGF SSWEQHDSPS SLSLSCKRLR PLAPKLSGSP PSPPSSSSGV TSATFDLKSF  60
IKPDQTGPRK FEYSLEHKRD LPQVETHPGG TRWNPTQEQI GILEMLYKGG MRTPNAQQIE  120
HITSQLGKYG KIEGKNVFYW FQNHKARERQ KQKRNNLISL SCQSSFKNTI SVSNASVTMK  180
TRTSSSLDVR RESMVEKEEL MEENEYKRTC RSWGFENLEI ESRRNINSST NATMATTYNK  240
IIDNVTLELF PLHPEGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013700837.11e-157PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J91e-143WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A078FVV21e-157A0A078FVV2_BRANA; BnaA08g04100D protein
STRINGBra014055.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-141WUSCHEL related homeobox 4