PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g25830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 204aa    MW: 22934.7 Da    PI: 7.5018
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g25830genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF498.1e-161565151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               kr+e +  r vtfskRr+gi  K +ELS+LC+++   +++s  gk y+++s
  Tp1g25830 15 KRVEKDEDRMVTFSKRRTGIYNKLSELSILCGTDFGFLVYSGAGKPYTFAS 65
               689999*******************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-20766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.315767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-21882IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-15929IPR002100Transcription factor, MADS-box
PfamPF003191.6E-181663IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MREKKTKGKQ KIIIKRVEKD EDRMVTFSKR RTGIYNKLSE LSILCGTDFG FLVYSGAGKP  60
YTFASPSFEA VAERFLHGSH QPKMINGEGS SSSLAIVDAH KKVRMDELCK TFNNLMEEVD  120
AEDERGKCVA PSFQVECGGW WKVDPEDDGE AKQLLSRFEV LYEQLCEVAT GRRSRGRGSY  180
DASASSSSFH RANFTNGDDY NHHG
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp1g25830
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639481.19e-72PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_022569565.19e-72agamous-like MADS-box protein AGL29
TrEMBLA0A1J3J0728e-78A0A1J3J072_NOCCA; Agamous-like MADS-box protein AGL61
STRINGBo5g061120.14e-71(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.15e-48AGAMOUS-like 64