PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g18360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family Nin-like
Protein Properties Length: 843aa    MW: 94251.8 Da    PI: 5.5155
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g18360genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29555605252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Tp1g18360 555 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 605
                689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2544625IPR003035RWP-RK domain
PfamPF020423.3E-25557605IPR003035RWP-RK domain
SuperFamilySSF542771.23E-21737829No hitNo description
SMARTSM006665.4E-26743826IPR000270PB1 domain
PROSITE profilePS5174528.794743826IPR000270PB1 domain
PfamPF005641.2E-18744825IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-20744823No hitNo description
CDDcd064077.56E-43744824No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MEDSFLQTEN AVMDTEFMDG LLLDGCWLET TDGSEFLNLS PSTSSVSPFD PSSFMWSPTQ  60
DTSAISGVVS QIYGQDCSER SSLDEFQWNK RWWIGPGGGG SSVTERLVQA VEHIKDYTTE  120
RGSLIQLWVP VNRGGKQVLT TKEQPFSHDP TCQRLANYRE ISVNYHFSAE QDDSKALAGL  180
PGRVFLGKLP EWTPDVRFFR SEEYPRVQHA QDCDVRGTLA IPVFEQGSKI CLGVIEVVMT  240
TEMVKLRPEL ESICRALQAV DLRSTEVPIP RSLKGCDLSY KAALPEIRNL LRCACETHKL  300
PLAQTWVSCI QQSKSGCRHN DENYIHCVST IDDACYVGDP TVREFHEACS EHHLLKGQGV  360
AGKAFLTNGP CFSPDVSNYK KSEYPLSHHA NMFGLHGAVA IRLRCIHTGS ADFVLEFFLP  420
KDCDDLEEQR KMLNALSTIM AHVPRSLRTV TDKELEEESE VIEREEVTPK IENTLELHHL  480
HGNSLWSASL EEVQPIDSSN PQNLGLVFDG GHKPNDGFGL KRGFDYTEDS NVNESSTFSS  540
GYFSRMAEKK RTKADKTITL DVLRQYFAGS LKDAAKNIGV CPTTLKRICR QHGIQRWPSR  600
KIKKVGHSLQ KIQRVIDSVE GVSGPLPIGS FYANFPNLAS QSQELSQQAK TSPPPPPLQL  660
SKSPVSPYSH SSSSSQCCSS ETQLNSGATT DPSQANVGGA LKKASSEIDL QSSSLEETVL  720
TLSSLENIPQ GTQLLSSCQD DDFLRIKVSY GEENIRFRIR NSRRLTDLQW EIGKRFSIED  780
MSRYDLKYLD EDNEWVLLTC DEDVEECVDV CRTTPSHTIK LLLHVSSHHF AERSSATGYN  840
LWH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp1g18360
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306759.10.0protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGXP_006306759.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein