PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g17370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family bZIP
Protein Properties Length: 590aa    MW: 65297.1 Da    PI: 6.7501
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g17370genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.71e-07268330163
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                e+e +r rr   NRe+Ar   +R++a +eeL ++++ L+ eN+ L+ e +   ke ++l++ +
  Tp1g17370 268 EREERRVRRILANRESARQTIRRRQAMCEELSKRAADLTYENENLRREKDWALKEFQSLETIN 330
                6888999*****************************************999999999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001702.1E-7268330IPR004827Basic-leucine zipper domain
SMARTSM003383.4E-9268332IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.002270333IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.9E-7272338No hitNo description
SuperFamilySSF579595.55E-6272324No hitNo description
CDDcd147029.83E-13277324No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MAKIWVAVVL SVMLLVSINS VAVLAEEEQP TVGQRIDSAV TGVSNAFNEH GGSDAVETVS  60
STAKSVYGWF GDKAKEMGIH HQKLNRKMQT SYRPLNLMAQ RLPRKDPMKT LHAARSELEP  120
ISSCCSSSSP SVPSSSSYGE DAANMTELEA AEALADLAQL AIMREQVFES AASWGSKGKR  180
VRKRVKTDSP PCLKPADSET LPTPDLAEER AVKEEEEEDE VQPISGELTK VPVKTEINGE  240
TPKPNLAPTL RCRSSGCGRS RQNLSEAERE ERRVRRILAN RESARQTIRR RQAMCEELSK  300
RAADLTYENE NLRREKDWAL KEFQSLETIN KHLKEQVSKS VKPETKEPEE PPKPSQVEMS  360
TSSTPFYFYN QNPYQLFCWP QVTQSSNPMV SPLETQNGFT APFTTSGGAS AKTVTSQEHG  420
NPADDNGQKT HFFVVPCPWF LPCPDQSNGV PYAFQDPQRI VSSNGHHIDD SSAKPVEVTK  480
SLRSHLPTSI KEEDSGSTET RPLYDLNESA TEVLSEGGDG FPVAQQAYSF KHEDVSDSPN  540
GVTPMQPGHH VLISLPGKKQ GSLAAAEARK RRKELTRLKN LHGRQCRMQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1568573RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp1g17370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416500.20.0light-inducible protein CPRF2
TrEMBLD7KI330.0D7KI33_ARALL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10016640.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein