PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g11810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 351aa    MW: 39651 Da    PI: 6.2976
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g11810genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1018e-32185240156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+++LH+rF++a+++LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Tp1g11810 185 KQRRCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 240
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.281182242IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-27184243IPR009057Homeodomain-like
SuperFamilySSF466894.48E-17184243IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-28185240IPR006447Myb domain, plants
PfamPF002496.4E-6187238IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0016036Biological Processcellular response to phosphate starvation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0080022Biological Processprimary root development
GO:1901699Biological Processcellular response to nitrogen compound
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MIKNLSNVDY NQKRERCGQY IEALEEERRK IHVFQRELPL CLDLVTQAIE ACKKELPETA  60
PIDNVYGQSE CSEQTTGECR PVLEQFLTIK DSSTSNEEEE VDEEFDDEHG NHDPDSDSED  120
KNMKSDWLKS VQLWNQPDPL LPKEERPQQK MTETVVKKDE IMRKDPMANG GEGRKREAEK  180
DGGRKQRRCW SSQLHRRFLN ALQHLGGPHV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH  240
TRRPNQTVSN NGNPQTQHFV VVGGLWVPQS DYSTGKTTGG ATTSGTTTTT TTTGIYGAMG  300
APPPPQWPSH SNFRPSIIGE EGSGSHSEEV VVRCSSPAMS SSTRNYYVKK N
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00140DAPTransfer from AT1G13300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010495195.10.0PREDICTED: transcription activator GLK1-like isoform X1
TrEMBLA0A078ILG60.0A0A078ILG6_BRANA; BnaC08g15800D protein
STRINGBra016734.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.10.0G2-like family protein