PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g10140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GeBP
Protein Properties Length: 385aa    MW: 42598.1 Da    PI: 5.2521
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g10140genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573138.12.8e-43157252297
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                +fqr+wseeDei++LqGlid+k++tg++p+dd +afy+ vk+sisf+vsk ql+eK+r+LKkKf+++  k k+g+ep+fsk+hd+k+f+lsk +Wg
  Tp1g10140 157 YFQRVWSEEDEIAVLQGLIDYKNDTGVNPYDDSNAFYQLVKESISFDVSKIQLMEKLRSLKKKFENNLGKGKNGEEPTFSKPHDRKAFDLSKFVWG 252
                79*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-35158252IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSGKRFNPLE DPPNASSSAE EDEVETSIGE GEEVRGNSSS EEDDDESRNS ALKKPETALA  60
AREKQRVSDS ESGSDEETDT DSETEKKQPV KNPKSSVVKS VAGTKDSVVA KNQDSKKGKP  120
SAKSATKKRS SETDGAVAST DAKRAKRVSG EETKKTYFQR VWSEEDEIAV LQGLIDYKND  180
TGVNPYDDSN AFYQLVKESI SFDVSKIQLM EKLRSLKKKF ENNLGKGKNG EEPTFSKPHD  240
RKAFDLSKFV WGADGMALES AVKSNGKSKK SRKSKKVEPV KPELVSSFPN GENCEDEVTA  300
NKGEAPSIAE LDAFVKSVLV KSLARFGVDD LAAQQGWSRF ASEDKKRFEE QWKGLQLREF  360
EFYSQKSGFI HEVVTKMAEA FRPDP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638352.11e-156PREDICTED: mediator-associated protein 1
TrEMBLA0A0D3C9B91e-156A0A0D3C9B9_BRAOL; Uncharacterized protein
STRINGBra019847.1-P1e-137(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-89DNA-binding storekeeper protein-related transcriptional regulator