PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g06610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family NF-YC
Protein Properties Length: 212aa    MW: 23884.8 Da    PI: 10.0374
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g06610genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC50.74e-161071941299
      NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka elfi   t  ++  + + k++ ++   +++av++ + ++fl d vp++
  Tp1g06610 107 GVEDAKTFRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATELFIKRCTEEAYETSVQDKKKFIHYKHLSSAVSNEERYEFLADYVPEK 194
                57899999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.5E-19101193IPR009072Histone-fold
PfamPF008083.0E-21115178IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.105.9E-25116193IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MVASRKPSEE KKPRSDGVNK AGGRNTRSSG SKTKKKTPNK AILEGIVKKE PEIYEISESS  60
STGSVEEARR DETKKSNGVV VNKGRDGKGG SIPANRRKNR EEEHGGGVED AKTFRFPMNR  120
IRRIMRSDNS APQIMQDAVF LVNKATELFI KRCTEEAYET SVQDKKKFIH YKHLSSAVSN  180
EERYEFLADY VPEKLKAEVA LEEWERSMTD AG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010458017.19e-93PREDICTED: uncharacterized protein LOC104739381
TrEMBLA0A087HLV72e-94A0A087HLV7_ARAAL; Uncharacterized protein
STRINGBra031606.1-P1e-87(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.14e-75nuclear factor Y, subunit C10