PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g05090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family LBD
Protein Properties Length: 197aa    MW: 22584.3 Da    PI: 10.1496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g05090genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.27.3e-3518109192
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++++++l+  k+
  Tp1g05090  18 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMIRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRISEELKLYKS 109
                7************************************************************************************9998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.22617117IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3218109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MMQRNTNNIS NNSSSHQACA SCKHQRKKCN NECILSPYFP ARKTKEFQAV HKVFGVSNVQ  60
KMIRTVREED RTKLSDSLTW EALWRQKDPV LGSYGEYRRI SEELKLYKSL VHNQPLIGWD  120
NNQRVFNSNN RNGLAVNSST GSGGFSVNNN GVGVNRELIN GGYTSRNLQG GWEHFKQDQR  180
QQCYAVINGF KQHYLPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-1819951288LOB family transfactor Ramosa2.1
5ly0_B4e-1819951288LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp1g05090
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738651e-163AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
GenBankCP0026841e-163CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF9P141e-163AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417938.11e-126LOB domain-containing protein 2
SwissprotQ9LNB91e-120LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ11e-124V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_006417938.11e-125(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-100LOB domain-containing protein 2