PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010559286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 534aa    MW: 59885 Da    PI: 6.4774
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010559286.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.94.1e-27301354256
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     ++++WtpeLH++Fv+aveqL G e+A+P++il+lmkv+gLt+++v+SHLQk+R++
  XP_010559286.1 301 KKVDWTPELHKKFVKAVEQL-GVEQAIPSRILDLMKVEGLTRHNVASHLQKFRMH 354
                     689*****************.9*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.2E-1116130IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.4E-1219155No hitNo description
CDDcd001566.05E-633127No hitNo description
Gene3DG3DSA:1.10.10.604.9E-26297356IPR009057Homeodomain-like
PROSITE profilePS5129415.503297356IPR017930Myb domain
SuperFamilySSF466891.13E-17299357IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23301354IPR006447Myb domain, plants
PfamPF002493.1E-7303351IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MVCTEDDLSN WRNFPKGLRV LLLDTEADTT SKLQSMDYIV TNFADESEAL SAYSKRPESF  60
HIAIVEVNAS DKNKSFEFLE AAKDLPTIMT SRDHCLTTMM KCIALGAVEF LHKPLSEDRL  120
ENIWQHVVHR AFNDGRSNVS GSLKPVKESV VSMLHLELGK QEENDDDMRT DEKDPAPSTP  180
QPKQGSSRLV DDGDCQENVN CSMEENVNSS NEKENTEDRD IGESKSVETT NRASDGNNVA  240
VKEEGEGETD DVKGQRQDTD PAHCLNQDDN NNNKDCRKSG HLTNDKPSGV KNVSGNKSNR  300
KKVDWTPELH KKFVKAVEQL GVEQAIPSRI LDLMKVEGLT RHNVASHLQK FRMHRRNILP  360
KEDHDHHHHH HRRWIQPRGH NHHLKIQTRY GGLSNRHVMA YPAPPMYHVW AHPTWPPTYP  420
PPVHGQAWGC PVGPPAIQPC HTCQNLTGPP RPPSSFSVQP EEEEVIDKVV KEAMSKPWLT  480
LPPSLPPPIS FWPSSPAVAS QPSLPPASST ALVSADVSSL LWMTSYIIRI NSTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16302358763ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010559286.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_010559285.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-176APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLM4D8131e-176M4D813_BRARP; Uncharacterized protein
STRINGBra012623.1-P1e-175(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.51e-152ARR-B family protein