PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010559145.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 328aa    MW: 37369.7 Da    PI: 6.4407
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010559145.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1652.6e-51111391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv++ k++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky++g r+nrat++g+Wkatg+dk +
  XP_010559145.1  11 VPPGFRFHPTEEELLQYYLRKKVSSVKIDL-DVIRDVDLNKLEPWDIQEmcKIGTaPQNDWYFFSHKDKKYPSGMRTNRATTAGFWKATGRDKII 104
                     69****************************.9***************953433333556**********************************99 PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +s +g+ +g++ktLvfykgrap+g+++dW+mheyrl
  XP_010559145.1 105 HS-NGQRIGMRKTLVFYKGRAPHGQRSDWIMHEYRL 139
                     99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-578175IPR003441NAC domain
PROSITE profilePS5100555.51611175IPR003441NAC domain
PfamPF023651.5E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MNISVNGQSQ VPPGFRFHPT EEELLQYYLR KKVSSVKIDL DVIRDVDLNK LEPWDIQEMC  60
KIGTAPQNDW YFFSHKDKKY PSGMRTNRAT TAGFWKATGR DKIIHSNGQR IGMRKTLVFY  120
KGRAPHGQRS DWIMHEYRLD DNISSDDTSV SFFVANITGE TSVEEGWVVC RTFKKKNLRK  180
TLTGGETTSS QMFNKETIER FPETMGRSGQ EELNIDPFRK HLTLESPSDA TSSYHDGPVN  240
SCHVRWEALD RFVASQLNGP TSYPTVDESH SDNDLALPTS FHGLNQLGLY QADLKQDFAP  300
DMELWNLAFG KTTSSLSDPL WHTSNGSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-48817714167NO APICAL MERISTEM PROTEIN
1ut4_B9e-48817714167NO APICAL MERISTEM PROTEIN
1ut7_A9e-48817714167NO APICAL MERISTEM PROTEIN
1ut7_B9e-48817714167NO APICAL MERISTEM PROTEIN
3swm_A1e-47817717170NAC domain-containing protein 19
3swm_B1e-47817717170NAC domain-containing protein 19
3swm_C1e-47817717170NAC domain-containing protein 19
3swm_D1e-47817717170NAC domain-containing protein 19
3swp_A1e-47817717170NAC domain-containing protein 19
3swp_B1e-47817717170NAC domain-containing protein 19
3swp_C1e-47817717170NAC domain-containing protein 19
3swp_D1e-47817717170NAC domain-containing protein 19
4dul_A9e-48817714167NAC domain-containing protein 19
4dul_B9e-48817714167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010559145.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010559145.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-153NAC43_ARATH; NAC domain-containing protein 43
TrEMBLD7LF861e-153D7LF86_ARALL; Uncharacterized protein
STRINGXP_010559145.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-155NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]