PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010559032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CPP
Protein Properties Length: 500aa    MW: 54380.3 Da    PI: 5.1421
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010559032.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.52e-16216254240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_010559032.1 216 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 254
                     689**********************************96 PP

2TCR53.25.8e-17301339139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  XP_010559032.1 301 RHKRGCNCKKSNCLKKYCECFQGGVGCSVNCRCEGCKNA 339
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19215256IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.678216341IPR005172CRC domain
PfamPF036385.1E-12218253IPR005172CRC domain
SMARTSM011142.2E-17301342IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.6E-12303339IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MEEEEAASIE PSNGNFETEP IGDRDSSEVV AMDLQKMCNV KSSKNDAPDW ESLISGSTDL  60
LIFSSPNDSE AFRDLMQPHA NNFTSDDPSN GEDNESTEAV SNFHRGLRRR CLDFVSPSEP  120
SSRCILPSIG LHLNAIAMSS KDSKASLLNE YSFPGKIHVS LPGANAHSKE NVRETREEDA  180
SQEVEDVSKA SVGEELNPSS PKKKRRKFDQ GGEGESCKRC NCKKSKCLKL YCECFAAGVY  240
CIEPCSCVDC FNKPIHEDTV LATRKQIESR NPLAFAPKVI RSSDPISEAG DDASKTPASA  300
RHKRGCNCKK SNCLKKYCEC FQGGVGCSVN CRCEGCKNAF GRKDGSSGIG SEGEQEEENE  360
TSEKNGTAKA QQNPEIFNEE EQNQSSGLPS TPLPLYRQPL VQLPFPSKNQ TVSQSLLGAG  420
SSSARQFSSF ETISEDGTED DMPEILVRSP IPTVKAVSPN SKRVSPPNLD SSGSILGRRN  480
GGRKLILQSI PSFPSLTPHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1621833812120Protein lin-54 homolog
5fd3_B1e-1621833812120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201205KKKRR
2201206KKKRRK
3202206KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010559032.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010559032.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_010559032.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-165TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]