PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010558708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 329aa    MW: 37208.1 Da    PI: 7.3037
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010558708.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.43.9e-55201471129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdee++++yLk++v ++++++  +i e+d++k+ePwdLpk++k +eke yfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ 
  XP_010558708.1  20 LPPGFRFHPTDEEIITYYLKERVFNSRFTA-VAIGEADLNKCEPWDLPKRAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIHKG 113
                     79*************************999.67***************99999*****************************************9 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     kg lvg+kktLvfy+grap+gekt+Wvmhe+rle
  XP_010558708.1 114 KGCLVGMKKTLVFYRGRAPRGEKTNWVMHEFRLE 147
                     *******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6215172IPR003441NAC domain
PROSITE profilePS5100558.55820171IPR003441NAC domain
PfamPF023651.4E-2821146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAVVEEGVVV SHGGQELVDL PPGFRFHPTD EEIITYYLKE RVFNSRFTAV AIGEADLNKC  60
EPWDLPKRAK MGEKEFYFFC QRDRKYPTGM RTNRATESGY WKATGKDKEI HKGKGCLVGM  120
KKTLVFYRGR APRGEKTNWV MHEFRLEGKY SYHNLPKSAR DEWVVCRVFH KNTTTPLMIK  180
KPFENLARMD SLENMDHLLD FSSLPPLMDT SFPGQPGPSF SGEFKPINHT PIYNNPTYYF  240
PHQPTLNPDS GPGSGWVYGS AYNASNNNNN KGMIKLEHSL VSVSTQETGL SSDMNATATP  300
EISSCPAAMM INGSKSYDEL GDLGILWDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4971722169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010558708.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010558708.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FK441e-164NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A1J3DX941e-170A0A1J3DX94_NOCCA; Uncharacterized protein
STRINGXP_010558708.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-151Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]