PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010558068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family LBD
Protein Properties Length: 161aa    MW: 17656.3 Da    PI: 7.7914
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010558068.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.31.5e-39111101100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C+++C++apyf +++pk+fa vhk+FGasnv+kll ++pe++r+++++sl+yeAe+r++dPvyG++g i +lq+++ +l+++la
  XP_010558068.1  11 SCAACKLLKRRCVPSCIFAPYFRSSDPKTFAKVHKVFGASNVSKLLVEIPEDQRQETVNSLAYEAEVRLKDPVYGCIGAIASLQRKMLELQHDLA 105
                     6*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      ++++
  XP_010558068.1 106 IARSR 110
                     99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.86810111IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3811108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCVPSCIFAP YFRSSDPKTF AKVHKVFGAS NVSKLLVEIP  60
EDQRQETVNS LAYEAEVRLK DPVYGCIGAI ASLQRKMLEL QHDLAIARSR LARATQVSVS  120
DDPAASLAGV LDIVPGYSEL MLLDGFTFDC SLYDLGQSPF V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4461136113LOB family transfactor Ramosa2.1
5ly0_B6e-4461136113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010558068.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010558068.11e-115PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL81e-85LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A087H8P05e-85A0A087H8P0_ARAAL; Uncharacterized protein
STRINGXP_010558068.11e-115(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.15e-88LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]