PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010557975.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TALE
Protein Properties Length: 675aa    MW: 73947.9 Da    PI: 6.6249
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010557975.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-093754121954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_010557975.1 375 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 412
                     554458******************************88 PP

2BELL116.51.3e-37224295172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kka+L+++l+eVd+rYkqy++q+++++ssFe++ag gsak YtslAlk+iS++FrcL dai+ qi
  XP_010557975.1 224 ERQEIQMKKARLVTMLDEVDQRYKQYHNQMRIIVSSFEQAAGSGSAKTYTSLALKTISKQFRCLNDAIKAQI 295
                     79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.4E-49149293IPR006563POX domain
PfamPF075264.0E-45155291IPR006563POX domain
PROSITE profilePS5007112.244353416IPR001356Homeobox domain
SMARTSM003891.6E-9356420IPR001356Homeobox domain
CDDcd000865.88E-12356417No hitNo description
SuperFamilySSF466895.99E-17357423IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28359422IPR009057Homeodomain-like
PfamPF059204.6E-18373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MATYFAGNLG IPGGEDGGHS AGAGGGGLGL HTMVLMNPTT YVHFNSGADQ DPPPNSSSAA  60
AAGNFILFNP STAGNFLASN QAPPQHFHDH DHNNNNTNSV NNVSAVLHGF IPRVYGTPVE  120
AARETPRANQ QGLSLSLYSE QQRPSFVVSG MQGSVLSSKY LKAAQELLDE VATVNENNTS  180
TENKNRKCLL SNKNGDEVDG KSAGESTRGA ETGDKVAAEL TVPERQEIQM KKARLVTMLD  240
EVDQRYKQYH NQMRIIVSSF EQAAGSGSAK TYTSLALKTI SKQFRCLNDA IKAQIKALNK  300
SLGGEEREED EEEGKAEGGS SSSSSRLKFV DHHLRQQRAL QQLGMIHHSN NNNNAWRPQR  360
GLPERAVSVL RSWLFEHFLH PYPKDSDKVM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE  420
MYLEEMKEHE KNNGSSKKKV NPNEHQDKED SMPKSVGYSD KKEKSHVSEA PQNSLMLRQD  480
SFMNNNGHGG ITMAVPVTAS ASATGFSISG ASELEGITQG SPKRVRINEI LHSPASVPSA  540
KMDFNIPERF RDEKEFSFLA SNTNFMGGNF GAYPIEEAGR FEAEEFTPSY SGNNNGVSLT  600
LGLPHCESFS VSAPTHQNFF PNQNIQIGRD VEMSEPNEFG AISTSESHSS AAAYNTISLQ  660
NQRRFSAQLL PDFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-16362420563Homeobox protein Meis2
4xrm_B4e-16362420563Homeobox protein Meis2
4xrs_A3e-16362419158Homeobox protein Meis1
4xrs_B3e-16362419158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010557975.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010557975.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-151BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A2I4DRV50.0A0A2I4DRV5_JUGRE; BEL1-like homeodomain protein 1
STRINGXP_010557975.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-132BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]