PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010557434.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 260aa    MW: 29569.1 Da    PI: 7.4047
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010557434.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.79.5e-49461712128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      pGfrF+Ptd el+++yL++k++g++ ++  vi+evdiy++ePwdLp k++ ++e ew+fF+ r ++y++g++++rat  gyWkatgk+++v+  
  XP_010557434.1  46 YPGFRFSPTDVELICYYLRRKIAGEERSV-AVIPEVDIYNYEPWDLPdKSILKSEGEWFFFCARGRRYPHGSQSRRATGLGYWKATGKERNVKM- 138
                     79************************999.89***************777777888*************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+k+tLvf+ grap+g +t+W+mhey l
  XP_010557434.1 139 GTQVVGTKRTLVFHIGRAPRGDRTEWIMHEYCL 171
                     99*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5534186IPR003441NAC domain
PROSITE profilePS5100552.27545187IPR003441NAC domain
PfamPF023651.3E-2547171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGMYDECTSR QSKFSSKAFF FLEKKKSLAG EMSRETEMSI AVSELYPGFR FSPTDVELIC  60
YYLRRKIAGE ERSVAVIPEV DIYNYEPWDL PDKSILKSEG EWFFFCARGR RYPHGSQSRR  120
ATGLGYWKAT GKERNVKMGT QVVGTKRTLV FHIGRAPRGD RTEWIMHEYC LIGAPPEALV  180
VCRLRKNCDF RANNNSGKKQ MQDADCDDHS NMSNDCFHHT DGGASEGENK NTDSFSASAS  240
EWKLWNDTNA ESSNNANIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-44341727143NO APICAL MERISTEM PROTEIN
1ut4_B5e-44341727143NO APICAL MERISTEM PROTEIN
1ut7_A5e-44341727143NO APICAL MERISTEM PROTEIN
1ut7_B5e-44341727143NO APICAL MERISTEM PROTEIN
3swm_A6e-443417210146NAC domain-containing protein 19
3swm_B6e-443417210146NAC domain-containing protein 19
3swm_C6e-443417210146NAC domain-containing protein 19
3swm_D6e-443417210146NAC domain-containing protein 19
3swp_A6e-443417210146NAC domain-containing protein 19
3swp_B6e-443417210146NAC domain-containing protein 19
3swp_C6e-443417210146NAC domain-containing protein 19
3swp_D6e-443417210146NAC domain-containing protein 19
4dul_A5e-44341727143NAC domain-containing protein 19
4dul_B5e-44341727143NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010557434.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010557434.10.0PREDICTED: NAC domain-containing protein 40 isoform X2
SwissprotQ9XIN76e-99NAC40_ARATH; NAC domain-containing protein 40
TrEMBLR0HQ771e-103R0HQ77_9BRAS; Uncharacterized protein
STRINGXP_010557433.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-101NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]