PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010557278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family Dof
Protein Properties Length: 342aa    MW: 36586 Da    PI: 10.0443
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010557278.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.37.8e-3983142261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++  l+cprCdstntkfCyynny+lsqPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk 
  XP_010557278.1  83 PDGPLNCPRCDSTNTKFCYYNNYNLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKG 142
                     566799***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2973138IPR003851Zinc finger, Dof-type
PfamPF027016.1E-3386141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.87987141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGFSSISSFI DPPNWPQPQT NSSQHNQQQG TGSVINGHEA LSHQISPLPT NPNPTHHHGG  60
GASARIGGGS TEERARVSKL PQPDGPLNCP RCDSTNTKFC YYNNYNLSQP RHFCKACRRY  120
WTRGGALRNV PVGGGCRRNK KGKTGNTNKS SASSSNNQNK QTATAQLQTN SQFSFLSTLQ  180
NLSQLGNIGL NLASINGNNQ AHFGLPNNSS GNSRSLMNEH GFLHVGIGAN STSGLMNSNN  240
INNNQNNILT SNQFAFFDPP TSGLYTFQSE GNMGINVVGL SSSSASMADS RVSQMAPVKT  300
EESHLINLSR PVPGLTSPEN NHFNQYWTGS GFSGSSSSGR LS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010557278.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010557278.10.0PREDICTED: dof zinc finger protein DOF2.2 isoform X1
SwissprotQ9ZV332e-97DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLA0A1J3GG632e-98A0A1J3GG63_NOCCA; Dof zinc finger protein DOF2.2
STRINGXP_010557278.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.14e-78Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]