PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010556655.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 320aa    MW: 35343.4 Da    PI: 6.869
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010556655.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.15.4e-3051355127
             NAM   5 frFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                     + F+P +eel+++yL++k++g++  +e+ i+e++i+++eP++Lp ++k +++++++F++r++k  + +r++r+t++g Wk tgk+  v++++g  
  XP_010556655.1   5 YTFNPPEEELINHYLNNKIAGNDDLVESEINEINICQHEPHNLPGQAKIRSSNTWYFVSRAEKFGRCNRTKRTTRTGHWKVTGKSCLVKDSGGVP 99 
                     68*********************888778***************77777777666777777888899**************************** PP

             NAM 100 vglkktLvfykgrapkge........ktdWvmheyr 127
                     +g kk Lvf + +a++++        +++Wv+he++
  XP_010556655.1 100 IGFKKFLVFQESKASSSSsssrnlphRSTWVIHEFH 135
                     **********65444433334444559********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.1261154IPR003441NAC domain
PfamPF023655.9E-175135IPR003441NAC domain
SuperFamilySSF1019415.36E-345154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MARPYTFNPP EEELINHYLN NKIAGNDDLV ESEINEINIC QHEPHNLPGQ AKIRSSNTWY  60
FVSRAEKFGR CNRTKRTTRT GHWKVTGKSC LVKDSGGVPI GFKKFLVFQE SKASSSSSSS  120
RNLPHRSTWV IHEFHSLLQH RNKDVFVLCK LMKKGGSGGS VASTDPFLSD PHEQITAGGD  180
VIMPMSSMVH NHYNDAEELF PEFHHNPNWF SVDLLLQSHF HPLQPQSFAH PIPTWNGGVP  240
IGEADSGMNP NYQETGELAC GSHVYGPNTE VSGGVGGYGS SGQTRFQTGS KAGTLGFVDP  300
RDLDILTRGD ISFDTPPTLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-15515821169NO APICAL MERISTEM PROTEIN
1ut4_B2e-15515821169NO APICAL MERISTEM PROTEIN
1ut7_A2e-15515821169NO APICAL MERISTEM PROTEIN
1ut7_B2e-15515821169NO APICAL MERISTEM PROTEIN
3swm_A2e-15515824172NAC domain-containing protein 19
3swm_B2e-15515824172NAC domain-containing protein 19
3swm_C2e-15515824172NAC domain-containing protein 19
3swm_D2e-15515824172NAC domain-containing protein 19
3swp_A2e-15515824172NAC domain-containing protein 19
3swp_B2e-15515824172NAC domain-containing protein 19
3swp_C2e-15515824172NAC domain-containing protein 19
3swp_D2e-15515824172NAC domain-containing protein 19
4dul_A2e-15515821169NAC domain-containing protein 19
4dul_B2e-15515821169NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010556655.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010556655.10.0PREDICTED: NAC domain-containing protein 1 isoform X2
TrEMBLA0A3P6DBT82e-67A0A3P6DBT8_BRACM; Uncharacterized protein
STRINGXP_010556652.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04430.11e-53NAC domain containing protein 49