PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010556381.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 352aa    MW: 39391.6 Da    PI: 5.1376
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010556381.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32199254156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+++LH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010556381.1 199 KQRRCWSQDLHRRFLNALQQLGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 254
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.611196256IPR017930Myb domain
SuperFamilySSF466891.04E-16197257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28197257IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-28199254IPR006447Myb domain, plants
PfamPF002491.3E-6201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MIKNIKNMDY SQNHKRFGEY IEALQEERRK ILVFQRELPL CLELVTQAIE ACKRETSDTM  60
ENMNGQSECS EQSTGDCGGL VLEEFIPIKP SFSSAHDDDD DEEEEEDEAE EEEDSDEHDD  120
DKNPKSDWLK SVQLWNQPDT IPIEERSREK ETVVEVKNNG VMCEKSNVDV ESRKTPATAD  180
GGGGGRKNEA VKDAGGKRKQ RRCWSQDLHR RFLNALQQLG GAQVATPKQI RELMKVDGLT  240
NDEVKSHLQK YRLHTRRPSQ TAGNGGNNQT PHFVVVGGIW VPQATAKSAA ATSATAGIYG  300
DMADPAPPQW PSHWNNFGPL ISHERSICHI EGGVRRIPPA MSSSSPKDRK KS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010556381.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLV4L6X81e-126V4L6X8_EUTSA; Uncharacterized protein
STRINGscaffold_101490.11e-122(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.11e-117G2-like family protein