PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010554998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 132aa    MW: 15477 Da    PI: 10.6446
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010554998.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.93.6e-3163116155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  XP_010554998.1  63 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 116
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.16E-2060120IPR009057Homeodomain-like
PROSITE profilePS512949.74860119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-3162121IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-2564116IPR006447Myb domain, plants
PfamPF002492.5E-866115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MREDNPNWLA RWEEELPPPE DLIPLSQTLI SPPLALAFHI DKFPPPPTDY AGDLTEPART  60
LKRPRLVWTP QLHKRFVDAV AHLGIKNAVP KTIMQLMSVE GLTRENVASH LQKYRLYLRR  120
IERVRRSISW RR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-2162121463ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114123RLYLRRIERV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010554998.13e-92PREDICTED: transcription factor PCL1
TrEMBLA0A078EJP22e-57A0A078EJP2_BRANA; BnaC05g42310D protein
TrEMBLA0A0D3CLC92e-57A0A0D3CLC9_BRAOL; Uncharacterized protein
STRINGBra029866.1-P1e-55(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.16e-44G2-like family protein