PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010554713.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 521aa    MW: 57819.4 Da    PI: 8.3029
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010554713.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10302360563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r + NR +A+rs +RK  +i eLe+kv+ L++e ++L  +l+  +     l se+
  XP_010554713.1 302 KRAKRIIANRQSATRSKERKARYILELERKVQILQTEATTLSAQLSLFQRDTNGLSSEN 360
                     9*****************************************99998887777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-16298362IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576300363IPR004827Basic-leucine zipper domain
PfamPF001701.1E-9302360IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.75E-10302353No hitNo description
Gene3DG3DSA:1.20.5.1706.6E-10302357No hitNo description
CDDcd147039.20E-21303352No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MPLYVCTLQF FETRSYFGGE CNCHGRSLGK ARNPGWGCDR EQALQIMIQE LSLKSNLVRC  60
LRMSVVKSLL KVIEKFPHVK HYREFKVPLA LELDVRDLVK SHFGVSYFDS ILLAMAMCSH  120
PQMNRILSCS RDRGSDGTGM EDPSNPKPNP SNHHLPQCPT PPPANPGAAA PAPAPFRGPY  180
HRRAHSEVQF RLPEDLELSD PFGGFDDLGS ADDLFCSYMD IEKLGSRSTS ASASDSAGPS  240
APRPDNLVPV ENEGGGRDDA RNSKPRHRHS LSVDGSSTLD SIEAKKAMAP DKLAELWVVD  300
PKRAKRIIAN RQSATRSKER KARYILELER KVQILQTEAT TLSAQLSLFQ RDTNGLSSEN  360
TELKLRLQAM EQQAKLRDAL NEALKKEVER LKSATGEMSR SDAYNLGIAM GCMQYPQSFF  420
QRQPQESQSD AHNLRMPPQF LLFQPNNRMP NSNIITSSSS RPLPSAHQPM LVTASGQSHS  480
FSEAMKQDPL GRLEDLDIGS CGRVSSCFRR SDSVSESSSA M
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010554713.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019059356.10.0PREDICTED: transcription factor RF2b-like isoform X2
SwissprotO228731e-167BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A178VZR11e-165A0A178VZR1_ARATH; Uncharacterized protein
STRINGXP_010554713.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-143bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]