PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010554240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 260aa    MW: 29735.4 Da    PI: 9.7943
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010554240.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like932.4e-29180235156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r+ W+ +LH+rF++a++qLGG++ AtPk+i+ +mkv gLt+++vkSHLQkYRl+
  XP_010554240.1 180 KQRRYWSRDLHRRFLNALQQLGGAHAATPKQIRGIMKVGGLTNDQVKSHLQKYRLH 235
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.381177237IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-26178237IPR009057Homeodomain-like
SuperFamilySSF466892.6E-17178237IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-26180235IPR006447Myb domain, plants
PfamPF002492.0E-5183233IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVKSINKVDY TRKRQTRGEC IETLEEERRK ILVFQREFPL CLELVTQTIE ACKREMSGTA  60
AADNMNSQWE CSEQTNGEYG RPILEEFMPI KRSSSGDEHG SHRSNGRTDD SDTKSDWLKS  120
VQLWNQPDQP TKEERLQEKE TVVGVERNGK ENRKTPETET IGGGDGMKNE AEKDVGVKRK  180
QRRYWSRDLH RRFLNALQQL GGAHAATPKQ IRGIMKVGGL TNDQVKSHLQ KYRLHTRGPS  240
QVLTTNVRLH HIPSAAAINK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176182VKRKQRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010554240.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLA0A078ILG68e-90A0A078ILG6_BRANA; BnaC08g15800D protein
STRINGAT1G13300.13e-89(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.18e-93G2-like family protein