PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010554113.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TCP
Protein Properties Length: 342aa    MW: 35678.4 Da    PI: 8.0194
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010554113.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP120.42.2e-3766137374
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasece 74 
                     +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+++++tgt++++as+ +
  XP_010554113.1  66 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSVIAATGTGTIPASALT 137
                     6999***************************************************************97662 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.6E-3170143IPR005333Transcription factor, TCP
PROSITE profilePS5136927.15671125IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDPKNTNQHQ VPNFLNPPSM QQQNQRMGDT NSNEKSGLNK EAEVKDHQIV VADKEVNKKQ  60
QQLLGPKRSS NKDRHTKVEG RGRRIRMPAL CAARIFQLTR ELGHKSDGET IQWLLQQAEP  120
SVIAATGTGT IPASALTASV TAAGGSGISL STGLMMNHDL SGGGIGGLGS SSRPNWPMVG  180
TGDGGGGGGE AASRAHHHNI PTALWPNVAS FAFQPPSGGG GGAGASTTGI ISESGGAGAG  240
AGGGYRIGLS GYDFPGVSNM GAMSFASILG SGSNNQMPGL ELGLSQDGNA GVLNQQALTQ  300
IYHQLDQARV PHHHHHHLHN QRRPHENQQE TSEKDDSQSS GL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00005PBMTransfer from 484486Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010554113.10.0PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD51e-105TCP20_ARATH; Transcription factor TCP20
TrEMBLR0HDZ91e-109R0HDZ9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__478__AT3G27010.11e-107(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40502759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-89TCP family protein