PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010554003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 319aa    MW: 36281.9 Da    PI: 8.3842
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010554003.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.8e-52151412128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                      pGfrFhPtdeelv +yLk+k+ +++l++ e ik+vdiyk++PwdLp+ ++ +ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+ 
  XP_010554003.1  15 LPGFRFHPTDEELVGFYLKRKILQRSLPI-ELIKQVDIYKYDPWDLPRLATMGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDRPIYSSd 108
                     69***************************.89***************8777899***************************************95 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  XP_010554003.1 109 GTKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 141
                     6667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-5913178IPR003441NAC domain
PROSITE profilePS5100556.16414178IPR003441NAC domain
PfamPF023651.4E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDEQSNVERF DDVVLPGFRF HPTDEELVGF YLKRKILQRS LPIELIKQVD IYKYDPWDLP  60
RLATMGEKEW YFYCPRDRKY RNSTRPNRVT GAGFWKATGT DRPIYSSDGT KCIGLKKSLV  120
FYRGRAAKGI KTDWMMHEFR LPSPSDHHHS PNNAKKLHLS NKDLPCCDSW AICRIFKKTV  180
NSVSSQRTLQ QSWICPKIPE NTHQSSTQTS TLFASYSSSS DILSQIAHQE HSVITTLPFP  240
PPSSSSAAAA VFTSQMLGVP YNCAKNNVNV SMETSFMNSN NNDHINYFNM EVVRSEECEN  300
GRVWFSGAGN VAGDGAVWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-551617819165NO APICAL MERISTEM PROTEIN
1ut4_B5e-551617819165NO APICAL MERISTEM PROTEIN
1ut7_A5e-551617819165NO APICAL MERISTEM PROTEIN
1ut7_B5e-551617819165NO APICAL MERISTEM PROTEIN
3swm_A5e-551617822168NAC domain-containing protein 19
3swm_B5e-551617822168NAC domain-containing protein 19
3swm_C5e-551617822168NAC domain-containing protein 19
3swm_D5e-551617822168NAC domain-containing protein 19
3swp_A5e-551617822168NAC domain-containing protein 19
3swp_B5e-551617822168NAC domain-containing protein 19
3swp_C5e-551617822168NAC domain-containing protein 19
3swp_D5e-551617822168NAC domain-containing protein 19
4dul_A5e-551617819165NAC domain-containing protein 19
4dul_B5e-551617819165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010554003.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010554003.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW51e-136NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A178UNX81e-134A0A178UNX8_ARATH; NAC094
STRINGXP_010554003.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-134NAC domain containing protein 94