PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010553582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TALE
Protein Properties Length: 563aa    MW: 62947 Da    PI: 7.5655
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010553582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-092953321954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_010553582.1 295 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 332
                     564459******************************88 PP

2BELL126.41.1e-40159230172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+s+l+eVd+rY+qy++q+q+vissFe++ag gsak+YtslAlk+iSr+FrcLk+ai++qi
  XP_010553582.1 159 ERQEIQMKKAKLISMLHEVDQRYRQYHHQMQIVISSFEQAAGTGSAKSYTSLALKTISRQFRCLKEAITGQI 230
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-6393228IPR006563POX domain
PfamPF075266.2E-4699227IPR006563POX domain
PROSITE profilePS5007112.26273336IPR001356Homeobox domain
CDDcd000861.85E-11276336No hitNo description
SMARTSM003892.3E-9276340IPR001356Homeobox domain
SuperFamilySSF466894.19E-17277343IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-29279343IPR009057Homeodomain-like
PfamPF059202.2E-18293332IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MGRGRPPRNN PPAVSAAAAE QNGFIPRVHY NLYNNNSDHQ LESTACETPR ASSQQGLSLT  60
LSSQQQQRQS HPQNLGFGLG SEEKIRVGSG VTNGVVSDLL SSKYLKAVQE LLDEVVNVNN  120
FMNISLFXCG GDKLSGGSSA GTGEGSAAEK SDVEVGTVER QEIQMKKAKL ISMLHEVDQR  180
YRQYHHQMQI VISSFEQAAG TGSAKSYTSL ALKTISRQFR CLKEAITGQI KAANKCLGEE  240
ESVFEGSRLK FVDHHFRQQR TLQQLGVIQH SNNNAWRPQR GLPERAVSVL RAWLFEHFLH  300
PYPKDSDKHM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE MYMEEMKKHE KNNESTDKTV  360
DENNEDLACK STSNQNKSPA ASENYRLNND LPNRNMDLEG VIGEQGSPKR RRTNDEMLIQ  420
PINTDFLSNE KLTVNHILEE GRGLRDGYSF LSNSFGQYQM DELPRFEVSD HMIEAQRAFS  480
GNNGVSLTLG LPRCETLSST HHHHQNFMPN HTIQLGRSVK IDGVPDEFGA MNASASSAPH  540
SSSGAYNGFN IENQKRFVGH LVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B9e-17282339158Homeobox protein Meis1
4xrs_A9e-17282339158Homeobox protein Meis1
3k2a_B9e-17282340563Homeobox protein Meis2
3k2a_A9e-17282340563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010553582.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM4DL960.0M4DL96_BRARP; Uncharacterized protein
STRINGBra017277.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1