PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010553468.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 366aa    MW: 42474.2 Da    PI: 6.4567
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010553468.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.3e-5571361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kkv++k+ e+ ++ik+vd+yk+ePwdL+   ++ + e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk++
  XP_010553468.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRAEI-DFIKDVDLYKIEPWDLNDlcRIGNeEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAI 100
                     69*************************999.99**************843555442556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +  +++l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_010553468.1 101 YL-RHSLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.16E-605156IPR003441NAC domain
PROSITE profilePS5100559.5317156IPR003441NAC domain
PfamPF023659.7E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKVA SKRAEIDFIK DVDLYKIEPW DLNDLCRIGN  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YLRHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTSQEEGWVV CRVFKKRMAA VRKMGDYETS PSHWYEDQLS  180
FMASEFETNS PRRILSSPYP SAYPLHNPNL QCKQELELQH YNHHHHHHLL HEPLFLQLPQ  240
LESPKFQQPN SNCSSLPLRT SNESGDNAAN FQPTNLGQEE RMDQGQQSLG SLYVNRENGQ  300
AVTDWRVLDK FVASQLSNEE ACASAQNNAN DQVDDEGMNL SENETKRVSE MGQEFAASSC  360
QIDPWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-50716017169NO APICAL MERISTEM PROTEIN
1ut4_B8e-50716017169NO APICAL MERISTEM PROTEIN
1ut7_A8e-50716017169NO APICAL MERISTEM PROTEIN
1ut7_B8e-50716017169NO APICAL MERISTEM PROTEIN
4dul_A8e-50716017169NAC domain-containing protein 19
4dul_B8e-50716017169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010553468.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010553468.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX20.0NAC7_ARATH; NAC domain-containing protein 7
TrEMBLD7KNA90.0D7KNA9_ARALL; Uncharacterized protein
STRINGXP_010553468.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.10.0NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]