PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010553390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 313aa    MW: 35787.5 Da    PI: 6.9494
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010553390.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM131.55.9e-4151402127
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.....lelee....vikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                     ppGfrF Pt+eelv +yLk+k+e+++              vi++vdiy+++P+dLp+     + +++ ++w fF++r+ +++tg r+nr t++gy
  XP_010553390.1   5 PPGFRFYPTEEELVGFYLKNKLESSRrdlnlS---PlidcVIPTVDIYDCDPSDLPQiwetmTRQKDPEQWIFFVSRRDSEKTGWRPNRLTAAGY 96 
                     9***********************99665552...044447***************65765322334459************************* PP

             NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     Wkatg+   v++ ++ +vg k+t+vfy+grap+g+kt+W m+ey+
  XP_010553390.1  97 WKATGSFGYVYT-NDVAVGGKRTMVFYTGRAPSGTKTEWRMNEYT 140
                     ************.999****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-423151IPR003441NAC domain
PROSITE profilePS5100542.7324197IPR003441NAC domain
PfamPF023651.6E-205140IPR003441NAC domain
SuperFamilySSF1019411.44E-42185197IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MEGIPPGFRF YPTEEELVGF YLKNKLESSR RDLNLSPLID CVIPTVDIYD CDPSDLPQIW  60
ETMTRQKDPE QWIFFVSRRD SEKTGWRPNR LTAAGYWKAT GSFGYVYTND VAVGGKRTMV  120
FYTGRAPSGT KTEWRMNEYT ALEPHHHHHH HHHHHPHHHH DHQHQAPSSS SLLVSSASTI  180
PPHAMRQDYS ICRVYTKSSR LRSFDRRPPQ PPPPPPQPQT PVNPNIYFNQ GQSQTGLVTH  240
SQPLAQNLGD GHTAEINASL PQQQQDHHHH HSSSSSLPSS SSSSSGNHHG NTDMVLIDEM  300
FWEQQLDSFF DYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-28414817149NO APICAL MERISTEM PROTEIN
1ut4_B7e-28414817149NO APICAL MERISTEM PROTEIN
1ut7_A7e-28414817149NO APICAL MERISTEM PROTEIN
1ut7_B7e-28414817149NO APICAL MERISTEM PROTEIN
3swm_A8e-28414820152NAC domain-containing protein 19
3swm_B8e-28414820152NAC domain-containing protein 19
3swm_C8e-28414820152NAC domain-containing protein 19
3swm_D8e-28414820152NAC domain-containing protein 19
3swp_A8e-28414820152NAC domain-containing protein 19
3swp_B8e-28414820152NAC domain-containing protein 19
3swp_C8e-28414820152NAC domain-containing protein 19
3swp_D8e-28414820152NAC domain-containing protein 19
4dul_A7e-28414817149NAC domain-containing protein 19
4dul_B7e-28414817149NAC domain-containing protein 19
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010553390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010553390.10.0PREDICTED: NAC domain-containing protein 90-like
STRINGXP_010553390.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.15e-48NAC domain containing protein 90