PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 276aa    MW: 31290.1 Da    PI: 8.5747
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552947.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.2e-53291561128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv++yLk+kv ++++++ ++i evdiyk+ePw+L   +k+k++++ewyfFs  dkky +g r nrat++gyWkatgkd+e+ 
  XP_010552947.1  29 LAPGFRFHPTDEELVSYYLKRKVLKRPVRF-NAIGEVDIYKHEPWELAvySKLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIR 122
                     579************************999.89**************85448899999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +++l+g+kktLvf++grap+g +t+Wvmheyrl
  XP_010552947.1 123 R-DTQLIGMKKTLVFHSGRAPDGLRTNWVMHEYRL 156
                     9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6123181IPR003441NAC domain
PROSITE profilePS5100557.83829180IPR003441NAC domain
PfamPF023652.3E-2831156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRESVALVT SPSAATPNAP ASAASATALA PGFRFHPTDE ELVSYYLKRK VLKRPVRFNA  60
IGEVDIYKHE PWELAVYSKL KTRDQEWYFF SALDKKYGNG ARMNRATNKG YWKATGKDRE  120
IRRDTQLIGM KKTLVFHSGR APDGLRTNWV MHEYRLVEYE VEKNGSMQQD AYVLCRVFHK  180
NNIGPPSGNR YAPFLEEEWD NGGNGMALIL GEDVRVMGES VPVLEDANGS NEFDQVNSCK  240
RRKPETYTIL SFGRNFSLDS RTSGDTVDEQ GSHQYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-502518213167NO APICAL MERISTEM PROTEIN
1ut4_B8e-502518213167NO APICAL MERISTEM PROTEIN
1ut7_A8e-502518213167NO APICAL MERISTEM PROTEIN
1ut7_B8e-502518213167NO APICAL MERISTEM PROTEIN
4dul_A8e-502518213167NAC domain-containing protein 19
4dul_B8e-502518213167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010552947.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552947.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
SwissprotQ9SQX91e-142NAC50_ARATH; NAC domain containing protein 50
TrEMBLA0A178VL851e-139A0A178VL85_ARATH; NAC050
TrEMBLD7L8Z51e-139D7L8Z5_ARALL; ANAC050
STRINGXP_010552946.11e-176(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-131NAC domain containing protein 50
Publications ? help Back to Top
  1. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]