PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552945.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 458aa    MW: 51420 Da    PI: 6.4433
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552945.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.5e-53291561128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv++yLk+kv ++++++ ++i evdiyk+ePw+L   +k+k++++ewyfFs  dkky +g r nrat++gyWkatgkd+e+ 
  XP_010552945.1  29 LAPGFRFHPTDEELVSYYLKRKVLKRPVRF-NAIGEVDIYKHEPWELAvySKLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIR 122
                     579************************999.89**************85448899999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +++l+g+kktLvf++grap+g +t+Wvmheyrl
  XP_010552945.1 123 R-DTQLIGMKKTLVFHSGRAPDGLRTNWVMHEYRL 156
                     9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6023181IPR003441NAC domain
PROSITE profilePS5100557.83829180IPR003441NAC domain
PfamPF023656.8E-2831156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MGRESVALVT SPSAATPNAP ASAASATALA PGFRFHPTDE ELVSYYLKRK VLKRPVRFNA  60
IGEVDIYKHE PWELAVYSKL KTRDQEWYFF SALDKKYGNG ARMNRATNKG YWKATGKDRE  120
IRRDTQLIGM KKTLVFHSGR APDGLRTNWV MHEYRLVEYE VEKNGSMQQD AYVLCRVFHK  180
NNIGPPSGNR YAPFLEEEWD NGGNGMALIL GEDVRVMGES VPVLEDANGS NEFDQEIQSM  240
SKDLININEL PRETQINNES TRVVPKPDNS LKHERSGEGG EEEEDCPPPL PPCTLNKEAP  300
LPLLQYKRRR QNELMGNSQN SSRTTQDHCS STTTTLTSSA ATNTAISALL EFSLMGTATD  360
NKKENPPLKP HKELSAPPPP RVGNKAGEVR EATLMIPENC TKLIDDLQKE IHQMSVERET  420
FKLEMMSAEA MISILQSRID ALRQENEELR KSGPVKGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-482818219170NAC domain-containing protein 19
3swm_B3e-482818219170NAC domain-containing protein 19
3swm_C3e-482818219170NAC domain-containing protein 19
3swm_D3e-482818219170NAC domain-containing protein 19
3swp_A3e-482818219170NAC domain-containing protein 19
3swp_B3e-482818219170NAC domain-containing protein 19
3swp_C3e-482818219170NAC domain-containing protein 19
3swp_D3e-482818219170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010552945.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552945.10.0PREDICTED: NAC domain-containing protein 82-like isoform X1
RefseqXP_010552946.10.0PREDICTED: NAC domain-containing protein 82-like isoform X2
SwissprotQ9SQY00.0NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A397ZF440.0A0A397ZF44_BRACM; Uncharacterized protein
STRINGXP_010552946.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.10.0NAC domain containing protein 50
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  4. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  5. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]