PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552902.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 289aa    MW: 31486 Da    PI: 7.0387
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552902.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-3097150155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  XP_010552902.1  97 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 150
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05994153IPR017930Myb domain
SuperFamilySSF466892.69E-2094154IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-3096155IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-2498150IPR006447Myb domain, plants
PfamPF002491.1E-7100149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MREEESNWFA RWEEELPSPE DLIPLSQSLI SPDLALAFDI RSPNHGICHS GHTHHQTTAH  60
QPPPPSSQAN SSADFAADSA DLGSGAAGDE SARTLKRPRL VWTPQLHKRF VDAVAHLGIK  120
NAVPKTIMQL MSVDGLTREN VASHLQKYRL YLKRMQGLSS GGGNGGVSGS DPATDRLFAS  180
SPVPAHFLHP TRAASSEHFT PSFVPLATLQ QQQMTAGSHH LQPPQFHHRQ MGHFENSFLA  240
RQTQQQAQRM AAPLQLHSPV GGNSYAEDLE SANAGGGRTV LTLFPTRDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2096155463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552902.10.0PREDICTED: transcription factor PCL1-like
RefseqXP_010552903.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB47e-53PCL1_ARATH; Transcription factor LUX
TrEMBLR0HMQ61e-133R0HMQ6_9BRAS; Uncharacterized protein
STRINGscaffold_301238.11e-121(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.15e-94G2-like family protein