PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552836.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 350aa    MW: 38842.8 Da    PI: 8.776
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552836.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.74.4e-57241501129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++kv + ++++ ++i evd++kvePwdLp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010552836.1  24 LPPGFRFHPTDEELVTHYLRPKVLNASFSA-RAIGEVDLNKVEPWDLPWRAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFK- 116
                     79**************************99.89***************888999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfykgrapkgekt+Wvmheyrle
  XP_010552836.1 117 GKSLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 150
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6521174IPR003441NAC domain
PROSITE profilePS5100561.07924174IPR003441NAC domain
PfamPF023651.2E-3025149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDYASRIGEV AEGVGELEEE RINLPPGFRF HPTDEELVTH YLRPKVLNAS FSARAIGEVD  60
LNKVEPWDLP WRAKMGEKEW YFFCVRDRKY PTGLRTNRAT EAGYWKATGK DKEIFKGKSL  120
VGMKKTLVFY KGRAPKGEKT NWVMHEYRLE GKYSADYLSK AAKNEWVICR VFQKRADGKK  180
VHISGLTGIG SHDNQFGSTS GLPPLTDSSP YIKFGGGDSL TGAGSASHVT CFSDQATAGR  240
ETPQRRLESN DRFTPPLFGS TLAFQPLSSS PSLPQLIPNN NIGSLLYSDS VFLQDSSILK  300
MLLQGQATEL SENYQKPVIS ESSGLIRGSF ERNIPSGSAG PVDMGCSWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-542118014171NO APICAL MERISTEM PROTEIN
1ut4_B5e-542118014171NO APICAL MERISTEM PROTEIN
1ut7_A5e-542118014171NO APICAL MERISTEM PROTEIN
1ut7_B5e-542118014171NO APICAL MERISTEM PROTEIN
4dul_A5e-542118014171NAC domain-containing protein 19
4dul_B5e-542118014171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010552836.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552836.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9LJW31e-135NAC59_ARATH; NAC domain-containing protein 59
TrEMBLV4KYS71e-149V4KYS7_EUTSA; Uncharacterized protein
STRINGXP_010552836.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29035.11e-129NAC domain containing protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]