PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552578.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 420aa    MW: 48013.5 Da    PI: 6.8413
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552578.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.7e-53121391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv++yLk+kv++++l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t++g+Wkatg+d++++s+
  XP_010552578.1  12 MLPGFRFHPTDEELVSFYLKRKVQQRPLSV-ELIRQLDIYKYDPWDLPKFATTGEKEWYFYCQRDRKYRNSTRPNRVTDAGFWKATGTDRPIYSS 105
                     579***************************.89***************8888899***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfy+gra kg+ktdW+mhe+rl
  XP_010552578.1 106 dGNKCIGLKKSLVFYRGRAAKGVKTDWMMHEFRL 139
                     56667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-5811168IPR003441NAC domain
PROSITE profilePS5100556.97412168IPR003441NAC domain
PfamPF023652.0E-2514139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MGDKNEGDHE FMLPGFRFHP TDEELVSFYL KRKVQQRPLS VELIRQLDIY KYDPWDLPKF  60
ATTGEKEWYF YCQRDRKYRN STRPNRVTDA GFWKATGTDR PIYSSDGNKC IGLKKSLVFY  120
RGRAAKGVKT DWMMHEFRLP SLSDPSAASP KRFFHNADSW AICRIFKKTN PTALRALSQS  180
FVSSLPPETA RDTRNRNPSN STQSYPDKIL KATSYNQFRH ENTDTAHQKP YSDDTNATNN  240
SANPFSYLDF TSYNQPSNVT NSLPFPDQQD LKSLLLAPQE TQLQFPKFTW NDISSFLLNT  300
SSDSSVFEGF SNQIDPSINF GEVMAHDQCP PLVSLPQEYQ KNGFEENVHM KNTRGVDGDG  360
CQYQTLGHMG FTLGDFTESV TDEDHQGLKQ RMLLDCSYPL LSSSISGELP SCFSITKCFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-511416819165NO APICAL MERISTEM PROTEIN
1ut4_B3e-511416819165NO APICAL MERISTEM PROTEIN
1ut7_A3e-511416819165NO APICAL MERISTEM PROTEIN
1ut7_B3e-511416819165NO APICAL MERISTEM PROTEIN
3swm_A3e-511416822168NAC domain-containing protein 19
3swm_B3e-511416822168NAC domain-containing protein 19
3swm_C3e-511416822168NAC domain-containing protein 19
3swm_D3e-511416822168NAC domain-containing protein 19
3swp_A3e-511416822168NAC domain-containing protein 19
3swp_B3e-511416822168NAC domain-containing protein 19
3swp_C3e-511416822168NAC domain-containing protein 19
3swp_D3e-511416822168NAC domain-containing protein 19
4dul_A3e-511416819165NAC domain-containing protein 19
4dul_B3e-511416819165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010552578.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552578.10.0PREDICTED: protein FEZ-like
SwissprotQ9ZVH01e-166FEZ_ARATH; Protein FEZ
TrEMBLA0A178WJ551e-163A0A178WJ55_ARATH; FEZ
STRINGXP_010552578.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-159NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]