PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 311aa    MW: 34805.2 Da    PI: 6.7947
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.2e-331872155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wt+eLH+rFveav+qLGG+ekAtPk ++++m ++gLtl+h+kSHLQkYRl
  XP_010552572.1 18 KPRLKWTSELHHRFVEAVNQLGGPEKATPKGVMKMMCIPGLTLYHLKSHLQKYRL 72
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-301672IPR009057Homeodomain-like
SuperFamilySSF466896.81E-171772IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-231873IPR006447Myb domain, plants
PfamPF002491.6E-82071IPR001005SANT/Myb domain
PfamPF143793.2E-21122168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MENIQKPSMN LVLSTDTKPR LKWTSELHHR FVEAVNQLGG PEKATPKGVM KMMCIPGLTL  60
YHLKSHLQKY RLGKSLQLGG SCVNDKHEEA VPADENQEVH TNNAHEGVEG GATKEKQDES  120
EQMEEALQMQ MEVQRKLHEQ IEVQRRLQVK IEAQGKYLQS VLKKAQETLS GYTSSNLGLA  180
FARSELSRLA SMVNNGGPSS SFSELTEAEE DEDEETKGGF LGSKKPKNVR PQTRCSVESS  240
LTSSESTETK SENCESFTRR SLELPLMEMR PEGMNTKKRR RSSNDAVCVE QPQEKRAVGV  300
YGGEHLRLSL S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552572.10.0PREDICTED: uncharacterized protein LOC104822910
SwissprotQ9SAK56e-47APL_ARATH; Myb family transcription factor APL
TrEMBLA8MSE51e-114A8MSE5_ARATH; Homeodomain-like superfamily protein
STRINGAT1G69580.21e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.21e-102G2-like family protein