PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NF-YA
Protein Properties Length: 305aa    MW: 33813.8 Da    PI: 9.6678
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552240.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.63.6e-32179235158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq+Rakle+++kl +k r+pylheSRh hAl+R+RgsgGrF
  XP_010552240.1 179 NEPIYVNAKQYHAILRRRQHRAKLEAQNKL-IKIRRPYLHESRHLHALKRARGSGGRF 235
                     59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.4E-36177238IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.018178238IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.3E-26180235IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.9E-24181203IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860183203IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.9E-24212235IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MQEFHRRDSP YTSSFTVTCP SWGNSVSSNS NVQGSSMTDS LSLTMEVMST HFPEMKQSGF  60
QLQDQDSSST QSTGQSSAEV ASFGEHNRYG HNVVAHLSGY EENAGKPSGS YSKSTSSMVS  120
QDSVFPPAQA SWPLHCSEPP PHFGGFMASA YASQPMMPHP QMMGLIPSRM PLPHNLPENE  180
PIYVNAKQYH AILRRRQHRA KLEAQNKLIK IRRPYLHESR HLHALKRARG SGGRFLNVKK  240
LQETKPPSPA ANVHPHHFSK NPPDPGIRPS GICSGSGSIT SCTDMNSKHN NDMFQHPQFR  300
FSGYP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-21179239262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010552240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552240.10.0PREDICTED: nuclear transcription factor Y subunit A-6-like
RefseqXP_010552241.10.0PREDICTED: nuclear transcription factor Y subunit A-6-like
RefseqXP_010552242.10.0PREDICTED: nuclear transcription factor Y subunit A-6-like
RefseqXP_010552243.10.0PREDICTED: nuclear transcription factor Y subunit A-6-like
SwissprotQ9LVJ71e-103NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLV4NPX01e-111V4NPX0_EUTSA; Uncharacterized protein
STRINGXP_010552240.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.19e-81nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]