PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010551716.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family VOZ
Protein Properties Length: 490aa    MW: 54636.9 Da    PI: 4.8944
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010551716.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ425.67.8e-1312294442217
             VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                     ppsaflgpkcalwdctrpaqg++w+q ycss+hatlal e++pgt+pvlrp+gi+lkd+ll++al+ak+qgk+vgipecega+++k+pwna+elf
  XP_010551716.1 229 PPSAFLGPKCALWDCTRPAQGFDWYQVYCSSYHATLALSEDSPGTKPVLRPGGISLKDNLLIDALRAKTQGKNVGIPECEGAVNTKCPWNATELF 323
                     7********************************************************************************************** PP

             VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvd 191
                     dl ++egetirewlffdkpr+afesgnrkqrslpdysgrgwhesrkq+mke+gg+krsyymdpqp++sfewhl+ey+i+e+d +alyrlelkl++
  XP_010551716.1 324 DLVMVEGETIREWLFFDKPRKAFESGNRKQRSLPDYSGRGWHESRKQLMKEQGGQKRSYYMDPQPPGSFEWHLFEYQIDECDLCALYRLELKLTN 418
                     *********************************************************************************************** PP

             VOZ 192 ekksakgkvskdsladlqkklgrlta 217
                     +kks+k+kv+kdsladlqkk+g+lta
  XP_010551716.1 419 TKKSPKAKVTKDSLADLQKKMGQLTA 444
                     ************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MSDHPKNQCT SSSHRVLVDN AKNRLNDLQE RFCNLQAARK EGRFGDLVVL EEQVYQSLRE  60
WQAELNAPSP ASSLLGGSIG LFSDEIARLL QLHDEEDDAT SALKEPTALE PESFAQGSSH  120
AEPAELKPEP FCQSPFNITF SSSQEEPTNN INTHGYQQHY AFQGFDQSSN TTSTLHDPAI  180
GNLDITSQLD YHLLEMRQQL DGNLPVKLDA TEECENYVDL DIPSNTCIPP SAFLGPKCAL  240
WDCTRPAQGF DWYQVYCSSY HATLALSEDS PGTKPVLRPG GISLKDNLLI DALRAKTQGK  300
NVGIPECEGA VNTKCPWNAT ELFDLVMVEG ETIREWLFFD KPRKAFESGN RKQRSLPDYS  360
GRGWHESRKQ LMKEQGGQKR SYYMDPQPPG SFEWHLFEYQ IDECDLCALY RLELKLTNTK  420
KSPKAKVTKD SLADLQKKMG QLTAEVISDK TSPPSKGRNK AASKGVHLAM DSPAKEDDNT  480
ITAAPSNDTP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBMTransfer from AT2G42400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010551716.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010551716.10.0PREDICTED: transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLV4P0Z40.0V4P0Z4_EUTSA; Uncharacterized protein
STRINGXP_010551716.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]