PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010550583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 315aa    MW: 36553.9 Da    PI: 6.3944
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010550583.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.7e-54161442129
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     ppG+rFhPtdeelv++yL+kkv+   +el +vik+vd+yk+ePwd+++   + ++ee+ewyfFs++dkky+tg+r+nrat+sg+Wkatg+dk+++
  XP_010550583.1  16 PPGYRFHPTDEELVDYYLRKKVACPGMEL-NVIKDVDLYKIEPWDIQQicgRGNGEEREWYFFSHKDKKYPTGTRTNRATASGFWKATGRDKAIY 109
                     9***************************9.99**************954555556888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_010550583.1 110 A-KHDLIGMRKTLVFYKGRAPNGHKSDWIMHEYRLE 144
                     *.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-5910164IPR003441NAC domain
PROSITE profilePS5100558.32415164IPR003441NAC domain
PfamPF023652.4E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0010981Biological Processregulation of cell wall macromolecule metabolic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0090058Biological Processmetaxylem development
GO:0005634Cellular Componentnucleus
GO:0009531Cellular Componentsecondary cell wall
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MFQESIEMTE MFLHIPPGYR FHPTDEELVD YYLRKKVACP GMELNVIKDV DLYKIEPWDI  60
QQICGRGNGE EREWYFFSHK DKKYPTGTRT NRATASGFWK ATGRDKAIYA KHDLIGMRKT  120
LVFYKGRAPN GHKSDWIMHE YRLETDENGP PQEEGWAVCR VFKKKPITTS NDFKNRRLIN  180
VGDQESWFTT QINSSMRYHH HLPPLLESPR TFQASSSSSE DDHNSTIYGD QDHDVNVASE  240
MMMMMNTSSD HHPLVDWRDL DKFVASQLMN QEVDEEISKA NGSDSSQETF HRVSDKQGKL  300
PLNASSGSCP LYPWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-4921656166NO APICAL MERISTEM PROTEIN
1ut4_B2e-4921656166NO APICAL MERISTEM PROTEIN
1ut7_A2e-4921656166NO APICAL MERISTEM PROTEIN
1ut7_B2e-4921656166NO APICAL MERISTEM PROTEIN
3swm_A2e-4921659169NAC domain-containing protein 19
3swm_B2e-4921659169NAC domain-containing protein 19
3swm_C2e-4921659169NAC domain-containing protein 19
3swm_D2e-4921659169NAC domain-containing protein 19
3swp_A2e-4921659169NAC domain-containing protein 19
3swp_B2e-4921659169NAC domain-containing protein 19
3swp_C2e-4921659169NAC domain-containing protein 19
3swp_D2e-4921659169NAC domain-containing protein 19
4dul_A2e-4921656166NAC domain-containing protein 19
4dul_B2e-4921656166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20952636, PubMed:20488898). Involved in xylem formation in roots and shoots, especially regulating metaxylem vessel differentiation by promoting immature xylem vessel-specific genes expression, especially genes regulating programmed cell death (PCD) and secondary wall formation in tracheary elements (TE) (PubMed:16103214, PubMed:20952636, PubMed:20488898). Can activate MYB25, MYB46, MYB58, MYB63, MYB83, MYB103, CESA4, LBD15, LBD30, ERF115, XCP1, XCP2, NAC010/SND3, KNAT7, ASL19 and ASL20 expression (PubMed:17890373, PubMed:18952777, PubMed:19088331, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:20952636). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:20952636}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00578DAPTransfer from AT5G62380Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010550583.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550583.10.0PREDICTED: NAC domain-containing protein 101 isoform X2
SwissprotQ9LVA11e-127NC101_ARATH; NAC domain-containing protein 101
TrEMBLA0A0D3BFT41e-131A0A0D3BFT4_BRAOL; Uncharacterized protein
STRINGXP_010550582.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.11e-128NAC-domain protein 101
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]