PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010550325.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 394aa    MW: 43721.7 Da    PI: 4.9279
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010550325.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.8e-32217271155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k r+rWt+eLHe+Fveav++LGG e+AtPk +l+lm+++gLt+++vkSHLQkYR+
  XP_010550325.1 217 KSRMRWTQELHEKFVEAVNELGGCERATPKGVLRLMNIPGLTIYNVKSHLQKYRT 271
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.286214274IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-30215272IPR009057Homeodomain-like
SuperFamilySSF466891.08E-17215271IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-24217271IPR006447Myb domain, plants
PfamPF002492.0E-10219270IPR001005SANT/Myb domain
PfamPF143794.8E-19303348IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MPWGTSSSLA NNGSDASCFI PPFTQLSSGM ASMSGFPHRT EPGSSSFVSR VLNDLSFPQP  60
SSGEGICLTP NDYSPSATEP HSYLNYPVEQ EGMPWSMDPL QGCFVISEHA VENVQVEDGT  120
ELIKSGHNFH ARDCQDLPEQ LICVDDALDQ SWDQLLADIN AQNPGPKIPN EIPNFMGQLQ  180
EVHESPVVPS EEQALTVNPP SSTSTAANPS CPAASTKSRM RWTQELHEKF VEAVNELGGC  240
ERATPKGVLR LMNIPGLTIY NVKSHLQKYR TARYIPDSSE GSSQKKSSSV DELRSVDLEK  300
TMGLTEALRL QMELQKHLHE QLENQRKLQL QIEEQGKCLQ MMIEKQREMQ EEVSEQNNSA  360
NANKNSSKKR RKDEGGDKSC SEFRHSSKKQ ALES
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1367371KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550325.10.0PREDICTED: protein PHR1-LIKE 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.35e-65G2-like family protein