PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010550093.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family LBD
Protein Properties Length: 317aa    MW: 36475.6 Da    PI: 6.2561
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010550093.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.5e-3949146198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++rr+C+kdC lapyfpa+qpk f+n+h+lFG+sn++k+lk++p+++re+a++s+ ye+ +r r Pv+G+++vi++l+ ql+++ ++l 
  XP_010550093.1  49 ACAVCKYQRRRCKKDCLLAPYFPADQPKVFQNAHRLFGVSNIQKILKDVPPDQREEAVKSIKYESFIRSRFPVHGCCEVIWHLRYQLHHATEQLR 143
                     7******************************************************************************************9998 PP

          DUF260  96 llk 98 
                     +++
  XP_010550093.1 144 HIH 146
                     876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.83148149IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-3749145IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MSVTTGRQTR RENVNKDNAV NVIVLLILSI LASVVMTLKG SSSGAGSQAC AVCKYQRRRC  60
KKDCLLAPYF PADQPKVFQN AHRLFGVSNI QKILKDVPPD QREEAVKSIK YESFIRSRFP  120
VHGCCEVIWH LRYQLHHATE QLRHIHGRIA SLKADQFRGQ TSEKPNDPMP YPDNYLADDN  180
AFPYMPNEYN GNFEPALDMK PFDIKAHEHH HVMQLPHYNN FYDHNQIENN SNYNGNNDCI  240
VDDNNNNTII NNHPLSLQQN TFVQHEIDDT HDYDEMSFDP LADDRHLASK ETCESSAESS  300
CFNLTTMEQT EDIRTFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-28411654127LOB family transfactor Ramosa2.1
5ly0_B3e-28411654127LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010550093.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550093.10.0PREDICTED: LOB domain-containing protein 12-like
STRINGXP_010550093.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-33LOB domain-containing protein 27