PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549796.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 485aa    MW: 55979.2 Da    PI: 4.9333
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549796.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.5e-5561331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeel+++yLk+k++g+++el e+i+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v 
  XP_010549796.1   6 LPPGFRFHPTDEELITYYLKRKINGREIEL-EIIPEVDLYKCEPWDLPgKtLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVS 99 
                     79****************************.99***************6335566899************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++++g+kktLv+y+grap+g +t Wvmheyrl
  XP_010549796.1 100 W-RDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                     9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-634157IPR003441NAC domain
PROSITE profilePS5100561.3676157IPR003441NAC domain
PfamPF023654.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090602Biological Processsieve element enucleation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING REIELEIIPE VDLYKCEPWD LPGKTLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDETECEH PASGLQDAYA LCRVFKKALI EGKPRELNSY VHKSPMSGIC  180
SSNLEVCSDL ESSTHQIQPY RTGQGQFCDE RFNPVDVGGV RDEDWARYLS NDMFAFPNYG  240
SSHAPSYPPP SKKVNTELEC AMLRHQTSLP PLRIENSPQE NDYFKTNQNN NGFEDFTFAA  300
SNSNLYNNDP FIPVGNLDHS SGWMRMPNND FNQGFIVEHN IVPDFDDNKE RDLEFGGESR  360
NNTVNNIEID DYLSFEIYNE DRVGEADEEG INTDETLNSS GFRVVEEIRV SHGMFIATRQ  420
ESETVFHQIV PSETLKVQIN PFDDYLEEMT SFGDGSESFL DKIKTKLTEI NLIAHQYYKT  480
IRVFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-54115712165NO APICAL MERISTEM PROTEIN
1ut4_B1e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_A1e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_B1e-54115712165NO APICAL MERISTEM PROTEIN
3swm_A1e-54115715168NAC domain-containing protein 19
3swm_B1e-54115715168NAC domain-containing protein 19
3swm_C1e-54115715168NAC domain-containing protein 19
3swm_D1e-54115715168NAC domain-containing protein 19
3swp_A1e-54115715168NAC domain-containing protein 19
3swp_B1e-54115715168NAC domain-containing protein 19
3swp_C1e-54115715168NAC domain-containing protein 19
3swp_D1e-54115715168NAC domain-containing protein 19
4dul_A1e-54115712165NAC domain-containing protein 19
4dul_B1e-54115712165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00329DAPTransfer from AT3G03200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010549796.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549796.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLV4N7S30.0V4N7S3_EUTSA; Uncharacterized protein
STRINGXP_010549796.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.10.0NAC domain containing protein 45
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]