PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010549663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 418aa    MW: 46523.3 Da    PI: 5.6428
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010549663.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.4e-34207261155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+lm+ +gLt++hvkSHLQkYR+
  XP_010549663.1 207 KQRMRWTPELHESFVEAVNQLGGSERATPKAVLKLMNNPGLTIYHVKSHLQKYRT 261
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-18206261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-31207263IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-24207261IPR006447Myb domain, plants
PfamPF002495.0E-11209260IPR001005SANT/Myb domain
PfamPF143791.5E-23298343IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MNNPVPCQAS PLVSGGDSGG RLFSPSSGFC SGMHVSSVSS HERNSQTQPS VSTMPRERAL  60
SRVAGEGQIQ DCPLEIQSQS LISHSQEQKD MPWCADPMQG FFDFPDHVPI QNPPAESSRG  120
MVSSEDLHKK SEWQEWADHL ISVDDGLEPN WSELLGDPSL QNHDSKISPQ SSDIPREEVK  180
IKQHQTVVSS GEQFSGKNSS SSAPPLKQRM RWTPELHESF VEAVNQLGGS ERATPKAVLK  240
LMNNPGLTIY HVKSHLQKYR TARYKPESSE GTEGEPSEKK LTSIEDIKSL DLKTSIGITE  300
ALRLQMEVQK RLHEQLEIQR KLQLQIEEQG RYLQKMFEKQ QKMQDNQNKG PNPDDDDDDP  360
SAPLQDQSSP SPKKSDSSGS QPRQDNVASR KEKKGDGFSS ADEDRSSSSP SKKRARED
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010549657.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_010549659.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X3
RefseqXP_010549660.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X3
RefseqXP_010549661.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X3
RefseqXP_010549662.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X3
RefseqXP_010549663.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X3
RefseqXP_010549664.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X3
SwissprotQ8GUN51e-160PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLF4J3P71e-160F4J3P7_ARATH; Myb family transcription factor
TrEMBLQ8GWU51e-160Q8GWU5_ARATH; At3g04445
STRINGAT3G04450.11e-159(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.21e-147G2-like family protein